LL-37 Cathelicidin Research Guide: Antimicrobial Peptide, Wound Healing, and Immune Biology

By Sam Smith

LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino-acid amphipathic alpha-helical peptide cleaved from the C-terminus of the hCAP18 precursor protein. The peptide is one of the most-studied antimicrobial peptides in published research, with documented activity against Gram-positive and Gram-negative bacterial pathogens, viruses, fungi, and biofilms. Beyond its antibacterial role, the cathelicidin LL-37 modulates wound healing, keratinocyte migration, inflammation, and immune cell function, giving it a dual antimicrobial activities and host-defence regulatory profile that few peptides match.

This guide walks through what LL-37 does at the membrane and receptor level, how the cathelicidin antimicrobial peptide kills bacterial cells while modulating mammalian immune responses, what the published research shows on wound healing and re-epithelialization, comparisons with KPV and other antiinflammatory peptides, dosage and administration considerations, side effects, and what researchers should look for when sourcing material. Every load-bearing claim links to its primary source in PubMed.

What does LL-37 peptide do?

The peptides LL-37 act through two parallel mechanisms: direct membrane disruption of microbial cells, and signal modulation of mammalian immune and epithelial cells. The membrane mechanism is responsible for the antimicrobial effect: the amphipathic alpha helix inserts into bacterial cell membranes, disrupting membrane integrity and killing the cell. According to a PubMed-indexed structural paper, LL-37 is an amphipathic, alpha-helical, antimicrobial peptide with the structural features that drive selective bacterial-membrane interaction.

The host-defence mechanism is responsible for the wound-healing and immune-modulating effects. LL-37 binds the formyl peptide receptor FPR2 and the P2X7 receptor on mammalian cells, triggering chemotaxis, cytokine release, and tissue-repair signal cascades that recruit immune cells to infected or injured sites while supporting epithelial regeneration.

LL-37 structure and origin

According to a PubMed-indexed structural-biology paper, LL-37 belongs to the cathelicidin family and is the first amphipathic alpha-helical peptide identified in humans within this family. The peptide is produced as a precursor protein (hCAP18) in neutrophils, epithelial cells, and several other tissue types. Proteolytic cleavage by proteinase-3 releases the active 37-residue antimicrobial peptide LL-37 (named for its two N-terminal leucines and 37-residue length). The peptide sequence is [LL-37, 37 aa]

How does LL-37 work as an antimicrobial agent?

The antimicrobial mechanism is well-characterised. The cationic LL-37 binds negatively charged microbial membranes (rich in phosphatidylglycerol and lipopolysaccharide) more strongly than mammalian cell membranes (rich in zwitterionic phosphatidylcholine). The peptide then inserts into the bacterial membrane in an alpha-helical conformation, forming transmembrane pores or disrupting the bilayer through carpet-mechanism aggregation. The result is rapid bacterial cell death through membrane depolarisation, ATP loss, and cytoplasmic leakage.

The activity extends beyond planktonic bacteria. According to a PubMed-indexed biofilm research paper, LL-37 has been shown to have antimicrobial and anti-biofilm activity against multiple Gram-positive and Gram-negative pathogens. The biofilm-disrupting activity is clinically interesting because bacterial biofilms (in chronic wounds, indwelling devices, cystic fibrosis lungs) resist most conventional antibiotics, and the cathelicidin mechanism can penetrate where traditional antibiotics cannot.

LL-37 in wound healing research

The wound healing data is the strongest non-antimicrobial application. According to a PubMed-indexed keratinocyte paper, LL-37 induces keratinocyte migration via heparin-binding-EGF-mediated transactivation of EGFR, providing the molecular mechanism for the wound re-epithelialisation effect. According to a PubMed-indexed diabetic wound paper, LL-37 significantly improved re-epithelialization and granulation tissue formation in diabetic mouse skin wounds, demonstrating wound-closure acceleration in a clinically relevant model.

The combined antimicrobial + wound-healing profile makes LL-37 particularly attractive for infected wound research: the peptide simultaneously kills the pathogens and accelerates the host repair process, unlike conventional topical antibiotics that address only the infection.

How does LL-37 influence inflammation and immune responses?

The immune-modulating effects are context-dependent and complex. At physiological concentrations, LL-37 recruits neutrophils, monocytes, and T-cells to infected tissues through chemotactic signal pathways. The peptide also binds LPS and neutralises endotoxin in plasma, reducing the systemic inflammatory response to gram-negative infections. At supraphysiological concentrations or in certain disease contexts, LL-37 can drive proinflammatory cascades through TLR3, TLR4, TLR7, and TLR9 activation, which contributes to autoimmune skin diseases (psoriasis, rosacea, lupus) where LL-37 levels are dysregulated.

Diseases associated with LL-37

LL-37 dysregulation appears in several disease contexts:

• Psoriasis: elevated LL-37 levels drive plasmacytoid dendritic cell activation and Th17 inflammation
• Rosacea: increased proteolytic activation of cathelicidin precursor produces aberrant LL-37 levels
• Atopic dermatitis: low LL-37 levels correlate with increased Staph aureus colonisation
• Cystic fibrosis: salt-sensitive LL-37 activity in the airway is compromised in CF mucus
• Chronic wounds: low LL-37 levels correlate with delayed healing in diabetic and venous ulcers
• COVID-19: LL-37 has antiviral activity against SARS-CoV-2 spike protein in some studies

The disease associations span both deficiency (chronic wounds, atopic dermatitis) and excess (psoriasis, rosacea), making LL-37 a useful research probe for dysregulated host defence biology.

Difference between KPV and LL-37

KPV and LL-37 are both short host-defence-related peptides but with different mechanisms:

• KPV: 3-amino-acid alpha-MSH fragment; antiinflammatory through NF-κB suppression; no direct antimicrobial activity
• LL-37: 37-amino-acid cathelicidin; direct antimicrobial through membrane disruption; complex immune-modulating effects
• KPV is most useful for sterile inflammation research (IBD, colitis, atopic dermatitis)
• LL-37 is most useful for infected-wound research (chronic ulcers, biofilm-associated infections)

The two peptides cover different niches in mucosal and skin immunology research and are not interchangeable.

LL-37 therapeutic applications and challenges

Therapeutic development of LL-37 has faced challenges including protease degradation (limits in vivo half-life), salt-sensitivity (reduced activity in high-ionic-strength environments like CF mucus), pro-inflammatory effects at high concentrations, and the difficulty of selectively targeting infected tissue without inducing systemic immune effects. LL-37 is not yet approved as a finished pharmaceutical anywhere. Synthetic analogues and shortened fragments are in development to address the stability and selectivity issues.

Dosage and administration in research

Research protocols use LL-37 in topical (1-100 μM in saline or hydrogel vehicles), local injection (10-1000 μg per dose), and in vitro culture (1-10 μM final concentration). The peptide is supplied as a lyophilised powder for reconstitution in sterile water or buffer. The short in vivo half-life means topical or local administration is the most-studied research route; systemic administration requires either repeated dosing or stabilised analogues.

Side effects of LL-37

Reported side effects in topical and local research applications are minimal: occasional mild local irritation, rare transient erythema at application sites, and rare reports of mild systemic mast-cell-related effects. The pro-inflammatory potential at high concentrations is the main concern, and explains the disease associations with chronic LL-37 elevation (psoriasis, rosacea). Researchers should avoid supraphysiological exposure in non-infected tissue contexts.

Legal status

LL-37 is not approved by Health Canada or the FDA as a finished pharmaceutical. It is legal in Canada and the United States as a research chemical sold under research-use-only labelling. The peptide is not on the World Anti-Doping Agency prohibited list.

Sourcing for research

Reproducible antimicrobial peptide research depends on the integrity of the input material:

• Batch-specific Certificate of Analysis from an independent third-party laboratory
• HPLC purity confirmation at 98 percent or above, with chromatogram trace
• Mass spectrometry verification of the expected ~4,493 Da molecular weight
• Endotoxin and sterility testing for in vivo or cell-culture work

Reviv Peptides supplies research-grade LL-37 with third-party COA and HPLC purity confirmation. View the Reviv Peptides shop for current availability.

LL-37 questions

What does LL-37 peptide do?

LL-37 acts through two parallel mechanisms: direct antimicrobial activity through bacterial membrane disruption, and host-defence signalling through FPR2 and P2X7 receptors that drives keratinocyte migration, immune cell recruitment, and tissue repair.

What are the side effects of LL-37?

In topical and local research use: mild local irritation, transient erythema, rare mast-cell-related effects. The main concern is pro-inflammatory potential at supraphysiological concentrations, which explains the disease associations with chronic LL-37 elevation.

What diseases are associated with LL-37?

Psoriasis, rosacea (excess LL-37); atopic dermatitis, chronic wounds, cystic fibrosis (deficient LL-37 or salt-inactivated activity). Both directions of dysregulation appear in human disease.

What is the difference between KPV and LL-37?

KPV: 3-amino-acid alpha-MSH fragment, antiinflammatory through NF-κB suppression, no antimicrobial activity. LL-37: 37-amino-acid cathelicidin, direct antimicrobial through membrane disruption plus immune-modulating effects. Different mechanisms, different applications.

How does LL-37 influence inflammation and immune responses?

Context-dependent. At physiological concentrations, LL-37 recruits immune cells, neutralises LPS, and supports antimicrobial defence. At supraphysiological concentrations, LL-37 can drive proinflammatory cascades through multiple TLRs, contributing to autoimmune skin diseases.

Summary

LL-37 is the only human cathelicidin and one of the most-studied antimicrobial peptides in published research. The amphipathic alpha-helical 37-residue peptide kills bacterial cells through membrane disruption while modulating wound healing, keratinocyte migration, and immune cell function through host-cell receptor binding. Strongest research applications are in infected wound healing (chronic ulcers, biofilm-associated infections), where the combined antimicrobial + repair-promoting profile is uniquely useful. Dysregulation of LL-37 levels appears in both directions across multiple human diseases (excess in psoriasis and rosacea; deficiency in chronic wounds and atopic dermatitis). Not approved as a finished pharmaceutical; legal in Canada and the United States as a research chemical under research-use-only labelling.

All products sold by Reviv Peptides are for research and educational purposes only and are not intended for human consumption. Not for diagnostic, clinical, or therapeutic use of any kind. Researchers should follow institutional biosafety policies for antimicrobial peptide handling.