LL-37 Cathelicidin Research Guide: Antimicrobial Peptide, Wound Healing, and Immune Biology

By Justin Cartier

Part of our overview of immune, reproductive and specialty peptides.

LL-37 is the only germ-fighting peptide the human body makes in the cathelicidin family. It’s a 37-amino-acid antimicrobial peptide that kills bacteria, viruses, and fungi, and on top of that, it helps wounds heal. That double act, host defense plus repair, is exactly why it’s one of the most-studied antimicrobial peptides in research.^[1]

This article is for research and educational use only. LL-37 is a research compound. It isn’t approved for human use, and nothing here is medical advice.

This guide covers what the peptide does at the cell level, how it kills germs while also steering the body’s own immune cells, what the research shows on wound healing, how it compares with KPV and other anti-inflammatory peptides, plus dosing, side effects, and what to check when sourcing it. Every key claim links back to its source on PubMed.

What does LL-37 peptide do?

It really does two jobs at once. It kills germs directly, and it fires off signals to the body’s own immune and skin cells. The germ-killing comes straight from its shape. As a cationic antimicrobial peptide, it slips into the outer wall of a microbe and cracks it open, killing the cell. Henzler Wildman and colleagues, in Biochemistry, mapped out how its amphipathic shape lets it target bacterial membranes on purpose.^[2]

The second job is the one that drives wound healing and immune tuning. The peptide binds the FPR2 and P2X7 receptors on human cells, and that pulls immune cells toward infected or injured spots, switches on repair signals, and helps the skin rebuild. So it isn’t just a killer, it’s also a traffic controller for the innate immune response.

LL-37 structure and origin

It starts life as part of a bigger parent protein. Oren and colleagues, in the Biochemical Journal, described how the human cathelicidin sits inside that precursor and was the first peptide of its kind found in humans.^[3] The body makes it as a precursor called hCAP18 in white blood cells, skin cells, and other tissues, and then an enzyme snips off the active 37-amino-acid piece, which is what we call LL-37, named for its two opening leucines and its 37 amino acids. Its sequence, for the record, is [LL-37, 37 aa]

How does LL-37 work as an antimicrobial agent?

Here’s the mechanism in plain terms: it kills germs by tearing open their outer walls. The peptide carries a positive charge, so it clings to the negatively charged walls of microbes far more than to human cell walls, which is what keeps it selective. Once it’s stuck, it slips into the microbe’s wall, pokes holes in it, and pulls it apart. The microbe dies fast, leaking its insides and losing its energy in the process.

And crucially, it doesn’t just hit free-floating bacteria, it works on biofilms too. Duplantier and colleagues, in Frontiers in Immunology, reviewed how this host-defence peptide fights both germs and the biofilms many bacterial species build.^[4] That matters a lot, because biofilms, the kind you find in chronic wounds, on medical devices, and in cystic fibrosis lungs, shrug off most standard antibiotics, whereas LL-37 can reach where those antibiotics can’t.

LL-37 in wound healing research

It speeds healing by getting skin cells to move and rebuild. Tokumaru and colleagues, in the Journal of Immunology, showed the peptide drives keratinocyte migration by switching on the EGF receptor, which is a big part of how a wound re-covers itself with skin.^[5] And Carretero and colleagues, in the Journal of Investigative Dermatology, found it clearly improved skin rebuilding and new tissue growth in diabetic mouse wounds, which is a notoriously hard-to-heal model.^[6]

That combo, germ-killing plus wound-healing, is what makes the peptide such a strong fit for infected-wound research. It clears the germs and speeds repair at the same time, which a plain topical antibiotic simply can’t do, since the antibiotic only handles the infection.

How does LL-37 influence inflammation and immune responses?

This is where it gets nuanced, because the effect flips depending on the situation. At normal levels, the peptide recruits neutrophils, monocytes, and T-cells to infected tissue and calms the LPS toxin from gram-negative germs, which actually dials the body’s broad inflammatory response down. But at very high levels, or in certain diseases, it can push inflammation up through several Toll-like receptors. That overdrive plays a real part in skin diseases like psoriasis, rosacea, and lupus, where its levels have tipped out of balance.

Diseases associated with LL-37

When it drifts out of balance, it turns up in a surprising range of conditions, and the interesting thing is it cuts both ways. In psoriasis, too much of it switches on immune cells and Th17 inflammation. In rosacea, extra cutting of the parent protein churns out abnormal levels. Atopic dermatitis is the flip side, where too little of it lets Staph aureus build up on the skin. In cystic fibrosis, the salt in CF mucus weakens its activity right in the airway. Chronic wounds tell the same low-level story, since low levels track with slow healing in diabetic and vein ulcers. And in COVID-19, some studies have shown it fighting the SARS-CoV-2 spike protein. Because those links span both too little (chronic wounds, atopic dermatitis) and too much (psoriasis, rosacea), the peptide makes a genuinely useful research tool for studying broken host-defense biology.

Difference between KPV and LL-37

KPV and LL-37 are both short defense-related peptides, but they work in totally different ways. KPV is a 3-amino-acid piece of alpha-MSH that calms inflammation by blocking NF-κB, and it doesn’t kill germs directly at all. LL-37 is the 37-amino-acid cathelicidin that kills germs by breaking their walls and also tunes the immune system on the side. That difference sorts their best uses cleanly: KPV shines in sterile inflammation research, think IBD, colitis, and eczema, while LL-37 is the tool for infected-wound research like chronic ulcers and biofilm infections. They cover different corners of skin and gut immune research, and they aren’t swaps for each other.

LL-37 therapeutic applications and challenges

Turning this peptide into an actual drug has been genuinely tough, for a few stacked reasons. Enzymes chew it up fast, so it doesn’t last long in the body. Salty environments like CF mucus blunt it. It can drive inflammation at high doses. And it’s hard to aim only at infected tissue without kicking off body-wide immune effects. So LL-37 isn’t an approved drug anywhere yet. What researchers are doing instead is building lab-made copies and shorter cathelicidin variants, the LL-37 derivatives, to make it more stable and more selective.

Dosage and administration in research

Research uses it a few ways: on the skin (1 to 100 µM in saline or gel), by local injection (10 to 1000 µg per dose), and in cell culture (1 to 10 µM final). It comes as a freeze-dried powder that you mix with sterile water or buffer before use. Because it breaks down quickly in the body, topical and local routes are the best-studied, while any whole-body use needs repeat dosing or a more stable version.

Side effects of LL-37

In topical and local research use, the side effects stay small: mild local irritation, the occasional brief redness at the spot, and rare mild mast-cell effects. The real thing to watch is that the peptide can drive inflammation at high doses, which is precisely why long-term high levels get linked to psoriasis and rosacea. So researchers should steer clear of very high doses in tissue that isn’t infected.

Legal status

Health Canada and the FDA have not approved LL-37 as a finished drug, so in both Canada and the United States it is sold only as a research chemical for laboratory use, and it isn’t on the World Anti-Doping Agency banned list. Our guide to buying peptides in Canada lays out the legal framework and how to vet a supplier.

When your protocol needs verified material, buy Canadian research peptides and check the batch COA on arrival.

How do I confirm the LL-37 I received is the real peptide?

Check the batch paperwork against LL-37’s known chemistry before you run anything. Ask for a Certificate of Analysis issued by a lab with no stake in the sale, and match two numbers on it. Mass spectrometry should read close to 4,493 Da, the average weight of the full 37-amino-acid sequence ([LL-37, 37 aa]), and HPLC purity should sit at 98 percent or higher with the chromatogram trace shown. If your protocol uses live animals or cell culture, add endotoxin and sterility testing on top. A mass that misses the expected weight, or a missing trace, means the vial may not be what the label claims.

Reviv Peptides supplies research-grade LL-37 with third-party COA and HPLC purity confirmation. View the Reviv Peptides shop for current availability.

LL-37 questions

What does LL-37 peptide do?

It does two jobs: it kills germs by breaking open their walls, and it signals through the FPR2 and P2X7 receptors to move skin cells, pull in immune cells, and repair tissue.

What are the side effects of LL-37?

In topical and local research use, mild local irritation, brief redness, and rare mast-cell effects. The main concern is that it can drive inflammation at very high doses, which is linked to chronically elevated levels in disease.

What diseases are associated with LL-37?

Psoriasis and rosacea from too much, and atopic dermatitis, chronic wounds, and cystic fibrosis from too little or salt-weakened activity. Both directions show up in human disease.

What is the difference between KPV and LL-37?

KPV is a 3-amino-acid alpha-MSH piece that calms inflammation through NF-κB and doesn’t kill germs. LL-37 is a 37-amino-acid cathelicidin that kills germs by breaking their walls and also tunes the immune system. Different jobs, different uses.

How does LL-37 influence inflammation and immune responses?

It depends on the situation. At normal levels it pulls in immune cells, calms the LPS toxin, and supports germ defense. At very high levels it can push inflammation up through several Toll-like receptors, which feeds into autoimmune skin diseases.

Summary

LL-37 is the only human cathelicidin and one of the most-studied antimicrobial peptides in research. This 37-amino-acid peptide kills germs by breaking their walls while also driving wound healing, skin-cell movement, and immune tuning through receptors on human cells. Its strongest research use is infected-wound healing, chronic ulcers and biofilm infections, where killing germs and speeding repair at once is uniquely useful. When it tips out of balance, it shows up in both directions across many human diseases: too much in psoriasis and rosacea, too little in chronic wounds and eczema. It isn’t an approved drug, and both Canada and the US treat it strictly as a laboratory research compound.

Sources: [1] LL-37 wound-healing activity (Carretero et al., 2008), PubMed. [2] Mechanism of membrane disruption by LL-37 (Henzler Wildman et al., 2003), PubMed. [3] Structure and organization of human LL-37 (Oren et al., 1999), PubMed. [4] LL-37 anti-biofilm activity (Duplantier & van Hoek, 2013), PubMed. [5] LL-37 induces keratinocyte migration via EGFR (Tokumaru et al., 2005), PubMed.